1

Using the amino acid sequence of the protein you identified in question 1D, answer the following...

Question

Using the amino acid sequence of the protein you identified in question 1D, answer the following...

Using the amino acid sequence of the protein you identified in question 1D, answer the following questions relating to humans.

The sequence is

MLSFVDTRTLLLLAVTSCLATCQCKCLQLVSGSLGKSGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFA AQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVG PQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSV GPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLPGAKGAAGLPGVAGA PGLPGPRGIPGPVGASGATGARGLVGEPGPAGSKGESGNKGEPGAVGQPGPPGPSGEEGKRGSTGEIGPAGPPGPPGLRG NPGSRGLPGADGRAGVMGPAGSRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPI GPAGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPGPDGNNGAQGPPGLQGVQGGKGEQGPAGPPGFQGLPGP AGTAGEAGKPGERGIPGEFGLPGPAGARGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAPGTAGPSGPSG LPGERGAAGIPGGKGEKGETGLRGDIGSPGRDGARGAPGAIGAPGPAGANGDRGEAGPAGPAGPAGPRGSPGERGEVGPA GPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGP SGISGPPGPPGPAGKEGLRGPRGDQGPVGRSGETGASGPPGFVGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRG ERGLPGVAGSVGEPGPLGIAGPPGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPVGAA GAPGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGD QGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVGPAGIRGSQGSQGPAGPPGPPGPPGPPGPSGGGYEFGFDGDFYRAD QPRSPTSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTG ETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMD EETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNI GPVCFK

A) What is the human homolog of the protein?

B) What is the predicted localization of the protein?

C) Where WITHIN a cell is the protein predominantly found?

Answers

According to NCBI Protein BLAST, the given amino acid sequence showed 100% identity to collagen alpha-2(I) chain [Bos mutus].

To find out the human homolog of the protein, following steps were taken

1. Copy and paste the given sequence on NCBI PROTEIN BLAST.

2. In the organism blank, put humans or homo sapiens.

3. Click on blast.

The human homolog of the protein was found out to be collagen, type I, alpha 2[Homo sapiens] with 92.32% identity.

The predicted localization of the protein in humans is connective tissues namely skin, tendon, bone. Accounting for more than 90% of the organic mass of the bone and being the major component of skin, ligaments and tendon.

The gene encoding this protein is present on chromosome 7.

It is synthesized as a procollagen precursor molecule which is then cotranslationally translocated into the lumen of rough endoplasmic reticulum. Hence within a cell the protein is predominantly found in the lumen of rough endoplasmic reticulum.

After post translational modification proper folding of the polypeptide takes place in the endoplasmic reticulum. Later the procollagen molecules are transported through the golgi complex and released out of the cell. Wherein the mature collagen molecules arrange themselves into long, thin fibrils which cross-link in the spaces between the cells forming a mesh like network of the collagen fibres.


Similar Solved Questions

1 answers
If the long-run market supply curve in a perfectly competitive industry is upward sloping, then the...
If the long-run market supply curve in a perfectly competitive industry is upward sloping, then the industry: -is a constant-cost industry. -is an increasing-cost industry. -exhibits constant returns to scale. -exhibits increasing returns to scale. -is a decreasing-cost industry....
1 answers
Average molar mass and abundance fractions
The relative molar mass of an element is known to be 32.064 g. Determine the abundance fraction of the isotope whose fraction is not displayed in the table.The relative molar mass of an element is known to be 32.064 g. Determine the abundance fraction of the isotope whose fraction is not displayed i...
1 answers
Problem 2 Find the contracted length of an 50 meter spaceship travelling at 90 percent the...
Problem 2 Find the contracted length of an 50 meter spaceship travelling at 90 percent the speed of light. b) If a 2 minute long song is played on this spaceship, how long is the song observed to be by a stationary listener?...
1 answers
Arning resource from Cengage Learning - Internet Explorer Im/takeAssignment/takeCovalentActivity.do?locator assignment-take&takeAssignmentSession Locator assignment-take References) Use the References...
arning resource from Cengage Learning - Internet Explorer Im/takeAssignment/takeCovalentActivity.do?locator assignment-take&takeAssignmentSession Locator assignment-take References) Use the References to access important values if needed for this question Nitrogen monoxide is produced by combust...
1 answers
Can Cr3+ oxidize Ag(s) ?
Can Cr3+ oxidize Ag(s) ?...
1 answers
Record the following transactions for Red Wood Trails in a general journal. June 3 Purchased $3,985...
Record the following transactions for Red Wood Trails in a general journal. June 3 Purchased $3,985 of merchandise on account from JVC Co. Purchased $2,300 of merchandise on account from Prime Target and Co. Credit terms 2/10, n/30. 9 12 Purchased $675 of store supplies on account from Craft Shop. 1...
1 answers
Instructions: 1. For cell D16 you need to use Vlookup it is based on the job...
Instructions: 1. For cell D16 you need to use Vlookup it is based on the job title of each employee. (3 columns in the table below) 2. Naming a range: the yellow cells in the table below-cells B31:236 should be named "Rate" 3. Use the range named Rate in your vookup D16 and copy the vookup t...
1 answers
Almost all medical schools in the United States require students to take the Medical College Admission...
Almost all medical schools in the United States require students to take the Medical College Admission Test (MCAT). To estimate the mean score μμ of those who took the MCAT on your campus, you will obtain the scores of an SRS of students. The scores follow a Normal distribution, and from publi...
1 answers
The following EBNF rules are a simplified version of the ones that are used to define...
The following EBNF rules are a simplified version of the ones that are used to define hexadecimal floating-point literals in the Swift language. Design a state diagram to recognize these literals. <hexadecimal-floating-point-literal> -> <hexadecimal-literal> [ <hexadecimal-fraction...
1 answers
Int kilobyte, megabyte, gigabyte, units; kilobyte = 8; megabyte = 8; gigabyte = 2; units =...
int kilobyte, megabyte, gigabyte, units; kilobyte = 8; megabyte = 8; gigabyte = 2; units = kilobyte + gigabyte; megabyte = 8; gigabyte= 7; find values of gigbytes, megabytes, kilobyte, units...
1 answers
Problems. The exam will be graded out of 300 points equalling up to 20% of your...
problems. The exam will be graded out of 300 points equalling up to 20% of your final grade. Good luck! 1. What does DFA stand for? (10 points) 2. Write the set former for the language with alphabet (a, b) that accepts strings that begin with a symbol a and end in another symbol a but also accepts a...
1 answers
Question 129 (1 point) Our landlord has vouched "no more illicit drug use in the building."...
Question 129 (1 point) Our landlord has vouched "no more illicit drug use in the building." It seems that our landlord had a drug abuse problem that we didn't know about previously. Question 129 options: a) Accident. b) Hasty Generalization. c) Begging the Question. d) Amphib...
1 answers
The volume of a cylinder is #81pi# cubic units. If the radius is 3 units, what is the height?
The volume of a cylinder is #81pi# cubic units. If the radius is 3 units, what is the height?...
1 answers
1. Determine the center of mass of Trod (thin ban), considering that the linear density varies...
1. Determine the center of mass of Trod (thin ban), considering that the linear density varies from a=20 in x=o the left end to double that value at. the right end 2=2 no at x=L L Suggestion : 2=7olita x, you must first determine the value of al 4 ) $3...
1 answers
Fallon Company uses flexible budgets to control its selling expenses. Monthly sales are expected to range...
Fallon Company uses flexible budgets to control its selling expenses. Monthly sales are expected to range from $166,300 to $208,000. Variable costs and their percentage relationship to sales are sales commissions 8%, advertising 4%, traveling 4%, and delivery 1%. Fixed selling expenses will consist ...
1 answers
By three ropes as shown. Determine the magnitude of the tension in each rope when a...
by three ropes as shown. Determine the magnitude of the tension in each rope when a person with a weight of Wp = 700 N is a distance d = 0.700 m from the left end. magnitude of T1      N magnitude of T2 N magnitude of T3 N...
1 answers
1. (20 pts) Calculate the magnetic field energy per unit length in a parallel plate structure,...
1. (20 pts) Calculate the magnetic field energy per unit length in a parallel plate structure, if each plate of width w conducts a current I in opposite directions. Assume the plates are separated a distance d by a medium of relative permeability Hr. What is the inductance per unit length?...
1 answers
Birch Company normally produces and sells 45,000 units of RG-6 each month. The selling price is $20 per unit, variable...
Birch Company normally produces and sells 45,000 units of RG-6 each month. The selling price is $20 per unit, variable costs are $10 per unit, fixed manufacturing overhead costs total $175,000 per month, and fixed selling costs total $32,000 per month. Employment-contract strikes in the companies th...
1 answers
Which of the following characteristics do land plants share with their closest algal relatives? Select all...
Which of the following characteristics do land plants share with their closest algal relatives? Select all that apply. populations of apical cells that maintain their meristematic identity multicellular haploid and diploid generations cytoplasm that may be continuously connected be...

-- 0.016488--