1

: What is the Schwarzschild radius, in kilometers, of a 13-MSun black hole? of a 2,500-MSun...

Question

: What is the Schwarzschild radius, in kilometers, of a 13-MSun black hole? of a 2,500-MSun...

: What is the Schwarzschild radius, in kilometers, of a 13-MSun black hole? of a 2,500-MSun black hole?

We used the equation........Rs=2.9 km (m/Msun)

1. What is the mass, in MSun, of a black hole whose Schwarzschild radius is 990 km?

      

Answers

PAGE NO.: DATE: 1 CaMass of Blactehol =13 Meun From d.9 in km Meun 13 Ms 2-9 y MS 2.9 X13 37. 2 km Mass ot black laole as00 M


Similar Solved Questions

1 answers
Testbank Exercise 136 * Your answer is incorrect. Try again. If $88,000 is deposited annually starting...
Testbank Exercise 136 * Your answer is incorrect. Try again. If $88,000 is deposited annually starting on January 1, 2020 and it earns 8%, how much will accumulate by December 31, 2029? (Round factor values to 5 decima places, e.g. 1.25124 and final answer to 0 decimal places, e.g. 458,581.) Click h...
1 answers
In a test of reaction time, we want to know if there is a difference in...
In a test of reaction time, we want to know if there is a difference in the speed at which people click on small vs. large buttons. 10 participants are presented with large button sizes and reaction times are measured (in milliseconds). Then 10 different participants, matched in age, are presented w...
1 answers
Name the Compound and Alkyne:
Name the Compound and Alkyne:...
1 answers
DDJ just issued an 8-year bond. The bond makes semi-annual coupon payments based on annual coupon...
DDJ just issued an 8-year bond. The bond makes semi-annual coupon payments based on annual coupon rate of 6%. If the bond is trading at $1,125.25, what is the bond's yield to maturity? 2.07% 2.01% 5.14% 5.97% None of the above...
1 answers
Consider the following function. (8 <A ri eve n of products) expression. Don't draw the gate...
Consider the following function. (8 <A ri eve n of products) expression. Don't draw the gate 1131 0 diagram yet. (b) Use De Morgan's Laws or "bubble pushing" to convert the SOP expression to something that can be directly implemented with only NAND/NOR/inverter gates. (c) Now draw...
1 answers
* Admission orders include giving alprazolam, 0.25 mg, three times daily. What schedule would be used...
* Admission orders include giving alprazolam, 0.25 mg, three times daily. What schedule would be used to administer these doses? * Describe the behavior monitoring system and intervention flow records used in the clinical setting when assigned to detect the adverse effects of anxiolytic drugs. * Dev...
2 answers
How could you use mental math to find 3x122
How could you use mental math to find 3x122?...
1 answers
Copper Borosilicate Glass 250 250 200 200 - 150 150 Stress (MPa) Stress (MPa) 100 100...
Copper Borosilicate Glass 250 250 200 200 - 150 150 Stress (MPa) Stress (MPa) 100 100 50 50 0.2 0.5 0.6 -4 5-10 0.001 Elongation (or Strain) 0.1 0.3 0.4 Elongation (or Strain) a) Copper Stress-Strain Curve 1 b) Borosilicate Glass Stress-Strain Curve Al = a Lo AT F - σΑ 6 AL AL lo A ssume...
1 answers
| JUJU | 32 | 333 47 48 49 50 QUESTION 23 Essential hypertension is caused...
| JUJU | 32 | 333 47 48 49 50 QUESTION 23 Essential hypertension is caused by which of the following? Drugs Pheochromocytoma Cancer No identifiable cause...
1 answers
A bank account pays 1.5% per year with annual compounding. You plan to deposit $25,000 per...
A bank account pays 1.5% per year with annual compounding. You plan to deposit $25,000 per year for each of the next 5 years. If the first payment occurs 1 year from today, how much money will be in the account 5 years from now, immediately following your last deposit? The answer is $128,806.67 - I ...
1 answers
Considering the migration patterns of the genus Homo,we learned that one of the following statements is false: 1.Homo sapienssuccessfully migrated into North America with the aid of a natural land bri...
Considering the migration patterns of the genus Homo,we learned that one of the following statements is false: 1.Homo sapienssuccessfully migrated into North America with the aid of a natural land bridge 2.Fossil records indicate that Homo neanderthalensismigrated to Eurasia 3. Homo ergasteroriginal...
1 answers
Using the amino acid sequence of the protein you identified in question 1D, answer the following...
Using the amino acid sequence of the protein you identified in question 1D, answer the following questions relating to humans. The sequence is MLSFVDTRTLLLLAVTSCLATCQCKCLQLVSGSLGKSGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFA AQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGE...
1 answers
5 hex-y Zetnyle ene aunich funcnoral groups aue DRsent? Letone ardlester b) knicn has the hgast...
5 hex-y Zetnyle ene aunich funcnoral groups aue DRsent? Letone ardlester b) knicn has the hgast pnonty Ester C) Hous many Camon atoms compn the lurgs Cran? a)unae Shoud you begin numenng tha langst carloun Chain, shaud yu lor astad to namu thic molecule Nark that pahcuar caraun aram an Phe Structue ...
1 answers
J, TU, 12, 13, 15) This Question: 1 pt 28 of 50 (23 complete arrangements are...
J, TU, 12, 13, 15) This Question: 1 pt 28 of 50 (23 complete arrangements are usually cheaper and require less engagement from the organization. A. Not this option OB. Equity Oc. Industrial OD. Non-Equity Click to select your answer....

-- 0.029070--